PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc11549.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 155aa    MW: 16904.4 Da    PI: 9.1786
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc11549.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.76.2e-133570338
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
                                  i n+++r  tf+kR++g+ KKA EL +LC+++va +
  Zpz_sc11549.1.g00010.1.am.mk 35 IPNHRQRVNTFAKRKEGLKKKAGELATLCGVRVAFV 70
                                  679999***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-102585IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-1825106IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.7692570IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-62747IPR002100Transcription factor, MADS-box
CDDcd002666.27E-2127104No hitNo description
PfamPF003194.1E-133571IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-64762IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDAFVPRAWL PGRPSGEAAV EEIKMPRRKI SMGLIPNHRQ RVNTFAKRKE GLKKKAGELA  60
TLCGVRVAFV CGFADGAGAA DVWESEPGVL DAYRDVPPEE RAKHTHRAYA EAELRKAEAK  120
LVRVRQEGPA ALAPGDAAVY ALTMDDAWRV LAAVD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455596.15e-32hypothetical protein SORBIDRAFT_03g013650
TrEMBLK7V0B57e-39K7V0B5_MAIZE; MADS transcription factor
STRINGGRMZM2G306610_P012e-38(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-09AGAMOUS-like 38